PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00048g01417.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 747aa    MW: 82776.7 Da    PI: 4.4915
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00048g01417.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.39.4e-10597638346
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               rW++++ el+++a +q+G++  ++I + ++ gRt+ q+ +++ k
  Peaxi162Scf00048g01417.1 597 RWSKQDTELFYEAMQQFGTD-LSLIQQLFP-GRTRRQLYHKYKK 638
                               9*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.1E-26588672No hitNo description
PROSITE profilePS512939.483593644IPR017884SANT domain
SMARTSM007177.5E-8594642IPR001005SANT/Myb domain
SuperFamilySSF466891.05E-9596644IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-5597638IPR009057Homeodomain-like
CDDcd001672.76E-6597638No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    Send to blast
SREVEAELKL DNSTKRLLLF CFSVASVIMD LLDDIFADSA AKTAKVGGKF QPKAKPRPMK  60
KGPVVASSAV SLTSKPSGDN ATTGSSEALK TGKNPQNYSE SSVLVEPSLE HPVAAEILGP  120
SVGSNLDTNT VIPDNNEDQN SCFEKSEGQT AEVCIGLDSS DDLLPHSSAI DPSGVYVAGA  180
EKGQEQPSFP VSSIDDSAPS TSNLQPNDVK TAEDPLTCQG SVVPISGSCQ EVGTYPSLEA  240
DILGVTTTSG LSIRRFQPKS KLQVYRERHD TSTPDSDVGE SVSYQPDSQL GHSEMDFVDK  300
GKEYGFPADD VLDFSARGFD NNVITESTHE SPVHEEYGME ASHSDAGIPA EHPEATSQIP  360
EEPVPQRPKA KRQKLRATNL SAISEENGVG RSLRSRRKSV NTNKLVDEPE EIIDDGEYVN  420
DSVTNGNDND AENFLVENES QGKNVQRKSK KTVTEEGKRV RKSKKTTEAS DQAANKKPKK  480
FSHSSRQKRR RGTSLIIVDK ALLEAPEDAI DYQKVPIKDL IILAEHKERL AKKDAAAAQI  540
PSTDQSVGAS VSNYDEDETH PSDEDEEATD HQVRPTVQDA DVCFNYQTYM VKTPSTRWSK  600
QDTELFYEAM QQFGTDLSLI QQLFPGRTRR QLYHKYKKEE RQNPFRFHDA LTNRSKDHSH  660
FERVIERLKQ IEAEELQKAD NDESIDLAGE EEVEGTQEIN EEEANSEQVE EKEVETMEQD  720
VQQMESPVKD YESEDDFLKW SQYKSEV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1446464RKSKKTVTEEGKRVRKSKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009761825.10.0PREDICTED: uncharacterized protein LOC104213954 isoform X2
TrEMBLM1BI380.0M1BI38_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000457280.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59022326
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.12e-47MYB_related family protein